Growth Research
CJC (no DAC) 5mg
5mg
CJC-1295 (no DAC), also known as Modified GRF(1-29), is a synthetic 29-amino-acid analog of growth-hormone-releasing hormone.
$50.00
The Collection
Front
Third-party testedComplimentary U.S. shippingShips in 24–48h
Certificate of Analysis
- View
Lot S26C593
99.27% · Vanguard LaboratoryReport V260204-18 · 10mg
For research use only — not for human or animal use.
Growth
SERMORELIN
$80.00
Strength · 10mg
Sermorelin is a truncated growth-hormone-releasing-hormone analog and one of the earliest studied secretagogues.
1
- Bulk
- 5+ vials — 5% · 10+ vials — 10% preferred rate
- Shipping
- Complimentary U.S. shipping
- Payment
- Card · Zelle · Venmo · Cash App
Research Notice
For laboratory research use only. Not for human consumption.
The Dossier
Research Notes
Sermorelin is a synthetic 29-amino-acid peptide corresponding to the first 29 residues of growth-hormone-releasing hormone — the shortest fragment that retains full biological activity, equipotent to the full-length molecule in stimulating growth-hormone secretion.
It remains a foundational reference compound in endocrine study, characterized for receptor engagement and its short-acting signaling profile.
Research Focus
- Pituitary growth-hormone-reserve models
- Age-related GH and IGF-1 decline research
- Cognitive-function and slow-wave-sleep models
- Body-composition models
- Oncology (glioma cell-cycle) research
Mechanism
Sermorelin binds the GHRH receptor on anterior-pituitary somatotroph cells, coupling primarily through Gs and adenylyl cyclase to raise cAMP, with associated MAPK signaling and calcium-facilitated vesicle fusion.
Because it stimulates natural pulsatile secretion and remains subject to somatostatin feedback, it is characterized as highly somatotroph-selective in vitro.
Molecular Profile
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ (29 aa)
- Molecular formula
- C₁₄₉H₂₄₆N₄₄O₄₂S
- Molecular weight
- 3357.9 Da
- CAS number
- 86168-78-7
- PubChem CID
- 16129620
- Also known as
- GRF(1-29) NH₂, GHRH(1-29)
Storage & Handling
Store the lyophilized peptide refrigerated at 2–8°C, protected from light. Reconstituted solution is held refrigerated over the medium term.
References
- Prakash A, Goa KL. Sermorelin: a review of its use in the diagnosis and investigation of idiopathic growth hormone deficiency. BioDrugs. 1999.
- Chang Y, et al. A potentially effective compound for patients with recurrent glioma: sermorelin. Ann Transl Med. 2021.
Related Research
Often explored alongside
Growth Research
CJC (no DAC)/Ipamorelin 5mg/5mg
5mg/5mg
Ipamorelin is a selective pentapeptide secretagogue studied for its targeted receptor activity in endocrine research.
$75.00
Growth Research
Ipamorelin 10mg
10mg
Ipamorelin is a synthetic pentapeptide growth-hormone secretagogue derived from the GHRP series, incorporating non-proteinogenic residues…
$75.00
Growth Research
Tesamorelin 10mg
10mg
Tesamorelin is a synthetic 44-amino-acid analog of growth-hormone-releasing hormone, distinguished by a trans-3-hexenoic acid group on the…
$80.00