Skip to content
20% off your first order with code WELCOME20. The Source — MMXXVI. Complimentary U.S. shipping. Third-party tested.
The Collection
Sermorelin 10mg — The Source house vial

Front

Third-party testedComplimentary U.S. shippingShips in 24–48h

Certificate of Analysis

  • Lot S26C593

    99.27% · Vanguard LaboratoryReport V260204-18 · 10mg

    View

For research use only — not for human or animal use.

Growth

SERMORELIN

$80.00

Strength  ·  10mg

Sermorelin is a truncated growth-hormone-releasing-hormone analog and one of the earliest studied secretagogues.

1
Bulk
5+ vials — 5% · 10+ vials — 10% preferred rate
Shipping
Complimentary U.S. shipping
Payment
Card · Zelle · Venmo · Cash App

Research Notice
For laboratory research use only. Not for human consumption.

The Dossier

Research Notes

Sermorelin is a synthetic 29-amino-acid peptide corresponding to the first 29 residues of growth-hormone-releasing hormone — the shortest fragment that retains full biological activity, equipotent to the full-length molecule in stimulating growth-hormone secretion.

It remains a foundational reference compound in endocrine study, characterized for receptor engagement and its short-acting signaling profile.

Research Focus

  • Pituitary growth-hormone-reserve models
  • Age-related GH and IGF-1 decline research
  • Cognitive-function and slow-wave-sleep models
  • Body-composition models
  • Oncology (glioma cell-cycle) research

Mechanism

Sermorelin binds the GHRH receptor on anterior-pituitary somatotroph cells, coupling primarily through Gs and adenylyl cyclase to raise cAMP, with associated MAPK signaling and calcium-facilitated vesicle fusion.

Because it stimulates natural pulsatile secretion and remains subject to somatostatin feedback, it is characterized as highly somatotroph-selective in vitro.

Molecular Profile

Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ (29 aa)
Molecular formula
C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular weight
3357.9 Da
CAS number
86168-78-7
PubChem CID
16129620
Also known as
GRF(1-29) NH₂, GHRH(1-29)

Storage & Handling

Store the lyophilized peptide refrigerated at 2–8°C, protected from light. Reconstituted solution is held refrigerated over the medium term.

References

  1. Prakash A, Goa KL. Sermorelin: a review of its use in the diagnosis and investigation of idiopathic growth hormone deficiency. BioDrugs. 1999.
  2. Chang Y, et al. A potentially effective compound for patients with recurrent glioma: sermorelin. Ann Transl Med. 2021.

Related Research

Often explored alongside

CJC (no DAC) 5mg — The Source

Growth Research

CJC (no DAC) 5mg

5mg

CJC-1295 (no DAC), also known as Modified GRF(1-29), is a synthetic 29-amino-acid analog of growth-hormone-releasing hormone.

$50.00

CJC (no DAC)/Ipamorelin 5mg/5mg — The Source

Growth Research

CJC (no DAC)/Ipamorelin 5mg/5mg

5mg/5mg

Ipamorelin is a selective pentapeptide secretagogue studied for its targeted receptor activity in endocrine research.

$75.00

Ipamorelin 10mg — The Source

Growth Research

Ipamorelin 10mg

10mg

Ipamorelin is a synthetic pentapeptide growth-hormone secretagogue derived from the GHRP series, incorporating non-proteinogenic residues…

$75.00

Tesamorelin 10mg — The Source

Growth Research

Tesamorelin 10mg

10mg

Tesamorelin is a synthetic 44-amino-acid analog of growth-hormone-releasing hormone, distinguished by a trans-3-hexenoic acid group on the…

$80.00