Recovery
ARA-290
10mg
$48.75$65.00
The Collection
Front
✦Third-party tested✦American made✦Ships in 24–48h
Recovery
LL-37
$56.25$75.00
Strength · 5mg
LL-37 is a human cathelicidin-derived peptide studied for its role in host-defense signaling and cellular-membrane research.
1
- Bulk
- 5+ vials — 5% · 10+ vials — 10% preferred rate
- Shipping
- Complimentary US shipping over $200
- Payment
- Card · Zelle · Venmo · Cash App
✦
✦
✦
Research Notice
For laboratory research use only. Not for human consumption.
The Dossier
Research Notes
LL-37 is a 37-residue cationic, amphipathic peptide — the only cathelicidin identified in humans. It is released from the precursor hCAP18 by proteolytic cleavage and expressed by neutrophils, monocytes, mast cells, and epithelial cells; its skin expression is regulated by vitamin D.
It is a well-defined reference compound for recovery research, characterized for its host-defense and membrane-interacting behavior in laboratory models.
Research Focus
- ✦Wound-healing models
- ✦Antimicrobial and anti-biofilm research
- ✦Antiviral and antifungal research
- ✦Endotoxin-neutralization (LPS) models
- ✦Bone-regeneration research
Mechanism
LL-37 is characterized as disrupting anionic microbial membranes through a carpet-like mechanism while sparing cholesterol-rich eukaryotic membranes. Beyond direct membrane activity it signals through receptors including FPR2, P2X7, EGFR, and TLR9, engaging ERK, p38 MAPK, PI3K/Akt, and NF-κB pathways.
It is reported to show a biphasic, concentration-dependent profile and to neutralize lipopolysaccharide.
Molecular Profile
- Sequence
- [LL-37, 37 aa] (37 aa)
- CAS number
- 154947-66-7
- Also known as
- Cathelicidin (hCAP-18 C-terminus), ropocamptide
Storage & Handling
Store the lyophilized peptide at −20°C. Reconstituted solutions are best used promptly or frozen; the peptide is documented as notably stable in certain formulated matrices.
References
- Johansson J, et al. Conformation-dependent antibacterial activity of the human peptide LL-37. J Biol Chem. 1998.
- Ridyard KE, Overhage J. The potential of human peptide LL-37 as an antimicrobial and anti-biofilm agent. Antibiotics. 2021.
✦Every vial ships with third-party HPLC verification; certificates of analysis are available on request.
Continue Exploring
