Skip to content
20% off your first order with code WELCOME20. The Source — MMXXVI. Complimentary U.S. shipping. Third-party tested.
The SourceTHE SOURCE
The Collection
LL-37 5mg — The Source house vial

Front

Third-party testedComplimentary U.S. shippingShips in 24–48h

Certificate of Analysis

  • Lot L26C602

    Vanguard LaboratoryReport V260204-18 · 5mg

    View

For research use only — not for human or animal use.

Recovery

LL-37

$75.00

Strength  ·  5mg

LL-37 is a human cathelicidin-derived peptide studied for its role in host-defense signaling and cellular-membrane research.

1
Bulk
5+ vials — 5% · 10+ vials — 10% preferred rate
Shipping
Complimentary U.S. shipping
Payment
Card · Zelle · Venmo · Cash App

Research Notice
For laboratory research use only. Not for human consumption.

The Dossier

Research Notes

LL-37 is a 37-residue cationic, amphipathic peptide — the only cathelicidin identified in humans. It is released from the precursor hCAP18 by proteolytic cleavage and expressed by neutrophils, monocytes, mast cells, and epithelial cells; its skin expression is regulated by vitamin D.

It is a well-defined reference compound for recovery research, characterized for its host-defense and membrane-interacting behavior in laboratory models.

Research Focus

  • Wound-healing models
  • Antimicrobial and anti-biofilm research
  • Antiviral and antifungal research
  • Endotoxin-neutralization (LPS) models
  • Bone-regeneration research

Mechanism

LL-37 is characterized as disrupting anionic microbial membranes through a carpet-like mechanism while sparing cholesterol-rich eukaryotic membranes. Beyond direct membrane activity it signals through receptors including FPR2, P2X7, EGFR, and TLR9, engaging ERK, p38 MAPK, PI3K/Akt, and NF-κB pathways.

It is reported to show a biphasic, concentration-dependent profile and to neutralize lipopolysaccharide.

Molecular Profile

Sequence
[LL-37, 37 aa] (37 aa)
CAS number
154947-66-7
Also known as
Cathelicidin (hCAP-18 C-terminus), ropocamptide

Storage & Handling

Store the lyophilized peptide at −20°C. Reconstituted solutions are best used promptly or frozen; the peptide is documented as notably stable in certain formulated matrices.

References

  1. Johansson J, et al. Conformation-dependent antibacterial activity of the human peptide LL-37. J Biol Chem. 1998.
  2. Ridyard KE, Overhage J. The potential of human peptide LL-37 as an antimicrobial and anti-biofilm agent. Antibiotics. 2021.

Related Research

Often explored alongside

ARA-290 10mg — The Source

Recovery Research

ARA-290 10mg

10mg

ARA-290, also known as cibinetide, is a synthetic eleven-amino-acid peptide modeled on the helix-B surface domain of erythropoietin.

$60.00

BPC-157 10mg — The Source

Recovery Research

BPC-157 10mg

10mg

BPC-157 is a synthetic pentadecapeptide derived from a protective sequence identified in gastric juice.

$60.00

BPC-157 20mg — The Source

Recovery Research

BPC-157 20mg

20mg

BPC-157 is a synthetic pentadecapeptide derived from a protective sequence identified in gastric juice.

$90.00

BPC/TB500 Blend 10mg/10mg — The Source

Recovery Research

BPC/TB500 Blend 10mg/10mg

10mg/10mg

TB-500 is a synthetic fragment of the naturally occurring protein Thymosin Beta-4, studied for its role in actin regulation and cellular…

$140.00